LMO4 Antibody (4H8)

Images

 
Immunocytochemistry/ Immunofluorescence: LMO4 Antibody (4H8) [H00008543-M01] - Analysis of monoclonal antibody to LMO4 on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: LMO4 Antibody (4H8) [H00008543-M01] - Detection limit for recombinant GST tagged LMO4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
4H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LMO4 Antibody (4H8) Summary

Immunogen
LMO4 (AAH17673, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Specificity
LMO4 (4H8)
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
LMO4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMO4 Antibody (4H8)

  • Breast tumor autoantigen
  • Crp3
  • Etohi4
  • LIM domain only 4
  • LIM domain only protein 4
  • LIM domain transcription factor LMO4
  • LMO4
  • LMO-4

Background

LIM domain only 4 is a cysteine-rich, two LIM domain-containing protein that may play a role as a transcriptional regulator or possibly an oncogene. Its mRNA is characterized by a GC-rich 5' region and by multiple ATTT motifs in the 3' region. A variant transcript missing a portion of the 5' region has been identified but cannot be confirmed because of the GC-rich nature of the region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31362
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
H00009079-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
AF2726
Species: Hu
Applications: Flow, ICC, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00004004-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-75090
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
314-BP/CF
Species: Hu
Applications: BA, BA
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NBP2-67451
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
MCS00
Species: Mu
Applications: ELISA
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
2458-RG
Species: Mu
Applications: Bind
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for LMO4 Antibody (H00008543-M01) (0)

There are no publications for LMO4 Antibody (H00008543-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO4 Antibody (H00008543-M01) (0)

There are no reviews for LMO4 Antibody (H00008543-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LMO4 Antibody (H00008543-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMO4 Products

Bioinformatics Tool for LMO4 Antibody (H00008543-M01)

Discover related pathways, diseases and genes to LMO4 Antibody (H00008543-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMO4 Antibody (H00008543-M01)

Discover more about diseases related to LMO4 Antibody (H00008543-M01).
 

Pathways for LMO4 Antibody (H00008543-M01)

View related products by pathway.

PTMs for LMO4 Antibody (H00008543-M01)

Learn more about PTMs related to LMO4 Antibody (H00008543-M01).
 

Research Areas for LMO4 Antibody (H00008543-M01)

Find related products by research area.

Blogs on LMO4

There are no specific blogs for LMO4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMO4 Antibody (4H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO4
Entrez
OMIM
Uniprot