Livin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Livin Antibody [NBP2-56859] - Staining of human cell line U-2 OS shows localization to nucleus & microtubule organizing center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Livin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE
Specificity
Specificity of human Livin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BIRC7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Livin Antibody

  • baculoviral IAP repeat containing 7
  • baculoviral IAP repeat-containing 7
  • BIRC7
  • KIAP
  • KIAPRING finger protein 50
  • Kidney inhibitor of apoptosis protein
  • livin inhibitor-of-apoptosis
  • Livin
  • Melanoma inhibitor of apoptosis protein
  • ML-IAP
  • MLIAPlivin inhibitor of apoptosis
  • ML-IAPmliap
  • RNF50LIVINbaculoviral IAP repeat-containing protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-37387
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-69210
Species: Hu, Bv, Ca, Eq, Rb
Applications: WB
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
NBP2-31106
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, ICC
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56311
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF8181
Species: Hu
Applications: WB, Simple Western, IHC, KO
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-76944
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB829
Species: Hu
Applications: WB, IHC
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP2-56859
Species: Hu
Applications: ICC/IF

Publications for Livin Antibody (NBP2-56859) (0)

There are no publications for Livin Antibody (NBP2-56859).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Livin Antibody (NBP2-56859) (0)

There are no reviews for Livin Antibody (NBP2-56859). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Livin Antibody (NBP2-56859) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Livin Products

Bioinformatics Tool for Livin Antibody (NBP2-56859)

Discover related pathways, diseases and genes to Livin Antibody (NBP2-56859). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Livin Antibody (NBP2-56859)

Discover more about diseases related to Livin Antibody (NBP2-56859).
 

Pathways for Livin Antibody (NBP2-56859)

View related products by pathway.

PTMs for Livin Antibody (NBP2-56859)

Learn more about PTMs related to Livin Antibody (NBP2-56859).
 

Research Areas for Livin Antibody (NBP2-56859)

Find related products by research area.

Blogs on Livin.

The Ins and Outs of Survivin
By Rachel M.A. Linger, Ph.D.What is survivin?Survivin is a small (16.5 kDa) protein normally found in human fetal tissue. In contrast, survivin is typically undetectable in most normal adult tissues. Expression of...  Read full blog post.

Survivin - an inhibitor of apoptosis protein
Survivin is an anti-apoptotic protein which is the smallest protein within a large family of proteins including X-linked IAP, c-IAP1 and 2, IAP-like protein-2, melanoma IAP, NAIP, and Livin. Survivin is responsible for a wide range of basic cellula...  Read full blog post.

Survivin is thrivin'
The survivin anti-apoptotic protein is the smallest member of a large family of proteins such as X-linked IAP, c-IAP1 and 2, IAP-like protein-2, melanoma IAP, Livin, and NAIP. Survivin regulates basic physiological events such as the cell cycle, tumor...  Read full blog post.

Livin: On a Prayer
Livin is a member of the inhibitor of apoptosis proteins (IAP) family that regulates programmed cell death. The Livin protein contains a single baculovirus IAP repeat (BIR) essential for function, along with a COOH-terminal RING-type zinc finger domai...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Livin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BIRC7