Recombinant Human LIS1 Protein

Images

 
SDS-Page: Recombinant Human LIS1 Protein [H00005048-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human LIS1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human LIS1

Source: Wheat Germ

Amino Acid Sequence: MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PAFAH1B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LIS1 Protein

  • LIS-1
  • LIS1PAF-AH alpha
  • LIS2
  • lissencephaly 1 protein
  • Lissencephaly-1 protein
  • MDCR
  • MDS
  • Miller-Dieker syndrome chromosome region
  • PAF acetylhydrolase 45 kDa subunit
  • PAF-AH 45 kDa subunit
  • PAFAH alpha
  • PAFAH
  • PAFAHA
  • platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
  • platelet-activating factor acetylhydrolase IB subunit alpha
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45kD)
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa
  • platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa)

Background

PAFAH1B1 - platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF5129
Species: Hu
Applications: WB
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB414
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
MAB414
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
NBP2-01086
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
7954-GM/CF
Species: Hu
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
7954-GM/CF
Species: Hu

Publications for LIS1 Partial Recombinant Protein (H00005048-Q01) (0)

There are no publications for LIS1 Partial Recombinant Protein (H00005048-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIS1 Partial Recombinant Protein (H00005048-Q01) (0)

There are no reviews for LIS1 Partial Recombinant Protein (H00005048-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIS1 Partial Recombinant Protein (H00005048-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for LIS1 Partial Recombinant Protein (H00005048-Q01)

Discover related pathways, diseases and genes to LIS1 Partial Recombinant Protein (H00005048-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIS1 Partial Recombinant Protein (H00005048-Q01)

Discover more about diseases related to LIS1 Partial Recombinant Protein (H00005048-Q01).
 

Pathways for LIS1 Partial Recombinant Protein (H00005048-Q01)

View related products by pathway.

PTMs for LIS1 Partial Recombinant Protein (H00005048-Q01)

Learn more about PTMs related to LIS1 Partial Recombinant Protein (H00005048-Q01).
 

Research Areas for LIS1 Partial Recombinant Protein (H00005048-Q01)

Find related products by research area.

Blogs on LIS1

There are no specific blogs for LIS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LIS1 Antibody
NBP1-03125
GM-CSF
7954-GM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LIS1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAFAH1B1