Recombinant Human LIS1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LIS1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 110 of Human PAFAH1B1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSP

Protein/Peptide Type
Partial Recombinant Protein
Gene
PAFAH1B1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LIS1 Protein

  • LIS-1
  • LIS1PAF-AH alpha
  • LIS2
  • lissencephaly 1 protein
  • Lissencephaly-1 protein
  • MDCR
  • MDS
  • Miller-Dieker syndrome chromosome region
  • PAF acetylhydrolase 45 kDa subunit
  • PAF-AH 45 kDa subunit
  • PAFAH alpha
  • PAFAH
  • PAFAHA
  • platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
  • platelet-activating factor acetylhydrolase IB subunit alpha
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45kD)
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa
  • platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa)

Background

PAFAH1B1 - platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01086
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for LIS1 Partial Recombinant Protein (H00005048-Q01) (0)

There are no publications for LIS1 Partial Recombinant Protein (H00005048-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIS1 Partial Recombinant Protein (H00005048-Q01) (0)

There are no reviews for LIS1 Partial Recombinant Protein (H00005048-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIS1 Partial Recombinant Protein (H00005048-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LIS1 Products

Bioinformatics Tool for LIS1 Partial Recombinant Protein (H00005048-Q01)

Discover related pathways, diseases and genes to LIS1 Partial Recombinant Protein (H00005048-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIS1 Partial Recombinant Protein (H00005048-Q01)

Discover more about diseases related to LIS1 Partial Recombinant Protein (H00005048-Q01).
 

Pathways for LIS1 Partial Recombinant Protein (H00005048-Q01)

View related products by pathway.

PTMs for LIS1 Partial Recombinant Protein (H00005048-Q01)

Learn more about PTMs related to LIS1 Partial Recombinant Protein (H00005048-Q01).
 

Research Areas for LIS1 Partial Recombinant Protein (H00005048-Q01)

Find related products by research area.

Blogs on LIS1

There are no specific blogs for LIS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LIS1 Antibody
NBP1-87769
GM-CSF [Unconjugated]
215-GM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LIS1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAFAH1B1