Lipoprotein Lipase/LPL Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lipoprotein Lipase/LPL. Source: E. coli Amino Acid Sequence: DQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
LPL |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58366. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Lipoprotein Lipase/LPL Recombinant Protein Antigen
Background
LPL, also known as Lipoprotein lipase, is a 475 amino acid that is 53 kDa, is a vascular lipase, but not synthesized in endothelial cells. It is anchored to the capillary endothelium by proteoglycans and acts as a catalyzer of triglycerides hydrolysis to release free fatty acids into the circulation and initiates the processing of triglyceride-rich lipoproteins such as chylomicrons and VLDL. It is being studied for its involvement in 150+ diseases and disorders including high density lipoprotein cholesterol level qtl 11, hyperlipoproteinemia, lipoprotein lipase deficiency, familial lipoprotein lipase deficiency, hyperlipoproteinemia type v, lipase deficiency combined, hyperlipoproteinemia type iii, glycogen storage disease, hyperlipidemia, hypertriglyceridemia, glucose intolerance, cetp deficiency, hypertension, fatty liver, nephrotic syndrome, kidney failure, and myocardial infarction. This protein has been shown to interact with 50 proteins including COPS6, PTPN4, RPL18A, ASCC2, KIAA1377 in developmental biology, transcriptional regulation of white adipocyte differentiation, lipid digestion, mobilization, and transport, metabolism, lipoprotein metabolism, glycerolipid metabolism, PPAR signaling pathway, and Alzheimer's disease pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: AC
Publications for Lipoprotein Lipase/LPL Recombinant Protein Antigen (NBP2-58366PEP) (0)
There are no publications for Lipoprotein Lipase/LPL Recombinant Protein Antigen (NBP2-58366PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lipoprotein Lipase/LPL Recombinant Protein Antigen (NBP2-58366PEP) (0)
There are no reviews for Lipoprotein Lipase/LPL Recombinant Protein Antigen (NBP2-58366PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Lipoprotein Lipase/LPL Recombinant Protein Antigen (NBP2-58366PEP) (0)
Additional Lipoprotein Lipase/LPL Products
Research Areas for Lipoprotein Lipase/LPL Recombinant Protein Antigen (NBP2-58366PEP)
Find related products by research area.
|
Blogs on Lipoprotein Lipase/LPL