LINGO-4 Antibody

Images

 
Immunohistochemistry-Paraffin: LINGO-4 Antibody [NBP2-31838] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LINGO-4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LINGO4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LINGO-4 Protein (NBP2-31838PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LINGO-4 Antibody

  • leucine rich repeat and Ig domain containing 4
  • leucine rich repeat neuronal 6D
  • LINGO4
  • LINGO-4
  • LRRN6D
  • PRO34002

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB36791
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF3086
Species: Hu
Applications: WB, IHC
MAB4899
Species: Hu
Applications: IHC
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
H00025878-R04
Species: Hu
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-14131
Species: Hu
Applications: WB, IHC, IHC-P
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NLS2167
Species: Hu, Po, Bt, Ca, Eq, Mk, Rb
Applications: IHC-P
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P

Publications for LINGO-4 Antibody (NBP2-31838) (0)

There are no publications for LINGO-4 Antibody (NBP2-31838).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LINGO-4 Antibody (NBP2-31838) (0)

There are no reviews for LINGO-4 Antibody (NBP2-31838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LINGO-4 Antibody (NBP2-31838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LINGO-4 Products

LINGO-4 NBP2-31838

Bioinformatics Tool for LINGO-4 Antibody (NBP2-31838)

Discover related pathways, diseases and genes to LINGO-4 Antibody (NBP2-31838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LINGO-4 Antibody (NBP2-31838)

Discover more about diseases related to LINGO-4 Antibody (NBP2-31838).

Blogs on LINGO-4

There are no specific blogs for LINGO-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LINGO-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LINGO4
Entrez
Uniprot