ISLR Antibody

Images

 
Western Blot: ISLR Antibody [NBP2-14131] - Analysis in human plasma.
Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ISLR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHG KAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISLR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ISLR Protein (NBP2-14131PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ISLR Antibody

  • HsT17563
  • immunoglobulin superfamily containing leucine-rich repeat protein
  • immunoglobulin superfamily containing leucine-rich repeat
  • ISLR
  • MGC102816

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4899
Species: Hu
Applications: IHC
AF1235
Species: Hu
Applications: WB, IHC
AF1620
Species: Mu
Applications: WB, IHC
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
H00025878-R04
Species: Hu
H00064220-D01P
Species: Hu, Mu
Applications: WB, ELISA
AF1246
Species: Mu
Applications: WB
H00051765-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-32162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-86156
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ISLR Antibody (NBP2-14131) (0)

There are no publications for ISLR Antibody (NBP2-14131).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISLR Antibody (NBP2-14131) (0)

There are no reviews for ISLR Antibody (NBP2-14131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ISLR Antibody (NBP2-14131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ISLR Products

Bioinformatics Tool for ISLR Antibody (NBP2-14131)

Discover related pathways, diseases and genes to ISLR Antibody (NBP2-14131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ISLR Antibody (NBP2-14131)

Discover more about diseases related to ISLR Antibody (NBP2-14131).
 

Pathways for ISLR Antibody (NBP2-14131)

View related products by pathway.

Blogs on ISLR

There are no specific blogs for ISLR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ISLR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISLR
Entrez