LIN-28A Recombinant Protein Antigen

Images

 
There are currently no images for LIN-28A Recombinant Protein Antigen (NBP3-21320PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LIN-28A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIN-28A

Source: E.coli

Amino Acid Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LIN28A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21320. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LIN-28A Recombinant Protein Antigen

  • CSDD1
  • CSDD1lin-28A
  • FLJ12457
  • lin-28 homolog (C. elegans)
  • lin-28 homolog A (C. elegans)
  • LIN28
  • LIN-28
  • LIN28A
  • LIN-28A
  • LIN28RNA-binding protein LIN-28
  • Tex17
  • ZCCHC1
  • ZCCHC1protein lin-28 homolog A
  • Zinc finger CCHC domain-containing protein 1
  • zinc finger, CCHC domain containing 1

Background

lin-28 homolog (C. elegans), also known as CSDD1, ZCCHC1. Entrez Protein NP_078950. LIN28 was first discovered in the nematode C. elegans. It is a heterochronic protein in C. elegans involved in the timing of developmental events and choice of stage specific cell fates. LIN28 expression has been found to be regulated post-transcriptionally by miRNAs in both nematodes and mammals. In humans it is expressed in embryonic stem cells and its expression decreases during differentiation. It is negatively regulated by retinoic acid in neuronal differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF3158
Species: Mu
Applications: ChIP, ICC, IHC, WB
NBP2-32352
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-71691
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-37357
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NB600-235
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB110-40579
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-03349
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
H00057167-M03
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
AF3184
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP1-84862
Species: Hu
Applications: ICC/IF, WB

Publications for LIN-28A Recombinant Protein Antigen (NBP3-21320PEP) (0)

There are no publications for LIN-28A Recombinant Protein Antigen (NBP3-21320PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIN-28A Recombinant Protein Antigen (NBP3-21320PEP) (0)

There are no reviews for LIN-28A Recombinant Protein Antigen (NBP3-21320PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LIN-28A Recombinant Protein Antigen (NBP3-21320PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LIN-28A Products

Research Areas for LIN-28A Recombinant Protein Antigen (NBP3-21320PEP)

Find related products by research area.

Blogs on LIN-28A.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LIN-28A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LIN28A