LIMPII/SR-B2 Antibody (1C8)

Images

 
Sandwich ELISA: LIMPII/SR-B2 Antibody (1C8) [H00000950-M01] - Detection limit for recombinant GST tagged SCARB2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, Flow
Clone
1C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LIMPII/SR-B2 Antibody (1C8) Summary

Immunogen
SCARB2 (NP_005497 339 a.a. - 437 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITN
Marker
Lysosome Marker
Specificity
SCARB2 (1C8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCARB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Flow Cytometry
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. FACS usage reported in scientific literature (PMID: 23919614).
Publications
Read Publication using H00000950-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LIMPII/SR-B2 Antibody (1C8)

  • AMRF
  • CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2(lysosomal integral membrane protein II)
  • CD36 antigen
  • CD36L2
  • CD36L2LIMP II
  • HLGP85
  • LGP85
  • LIMP-2,85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2
  • LIMPII
  • LIMPIICD36 antigen-like 2
  • LPG85
  • lysosome membrane protein 2
  • Lysosome membrane protein II
  • SCARB2
  • Scavenger receptor class B member 2,85 kDa lysosomal membrane sialoglycoprotein
  • scavenger receptor class B, member 2
  • SRB2
  • SR-B2
  • SR-BII

Background

The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Studies of the similar protein in mice and rat suggested that this protein may participate in membrane transportation and the reorganization of endosomal/lysosomal compartment. Deficiency of the similar protein in mice was reported to impair cell membrane transport processes and cause pelvic junction obstruction, deafness, and peripheral neuropathy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00000777-R01
Species: Hu
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
H00000950-M01
Species: Hu
Applications: ELISA, Flow

Publications for LIMPII/SR-B2 Antibody (H00000950-M01)(1)

We have publications tested in 1 application: FLOW.


Filter By Application
FLOW
(1)
All Applications
Filter By Species
All Species

Reviews for LIMPII/SR-B2 Antibody (H00000950-M01) (0)

There are no reviews for LIMPII/SR-B2 Antibody (H00000950-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LIMPII/SR-B2 Antibody (H00000950-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIMPII/SR-B2 Products

Bioinformatics Tool for LIMPII/SR-B2 Antibody (H00000950-M01)

Discover related pathways, diseases and genes to LIMPII/SR-B2 Antibody (H00000950-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIMPII/SR-B2 Antibody (H00000950-M01)

Discover more about diseases related to LIMPII/SR-B2 Antibody (H00000950-M01).
 

Pathways for LIMPII/SR-B2 Antibody (H00000950-M01)

View related products by pathway.

PTMs for LIMPII/SR-B2 Antibody (H00000950-M01)

Learn more about PTMs related to LIMPII/SR-B2 Antibody (H00000950-M01).
 

Research Areas for LIMPII/SR-B2 Antibody (H00000950-M01)

Find related products by research area.

Blogs on LIMPII/SR-B2

There are no specific blogs for LIMPII/SR-B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIMPII/SR-B2 Antibody (1C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCARB2
Entrez
OMIM
Uniprot