LIMD1 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQ |
Predicted Species |
Mouse (100%), Rat (98%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
LIMD1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for LIMD1 Antibody - BSA Free
Background
Transcriptional regulator that inhibits E2F-mediated transcription, and suppresses the expression of the majority of genes with E2F1-responsive elements. May act as a tumor suppressor by inhibiting cell proliferation
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Publications for LIMD1 Antibody (NBP3-17878) (0)
There are no publications for LIMD1 Antibody (NBP3-17878).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LIMD1 Antibody (NBP3-17878) (0)
There are no reviews for LIMD1 Antibody (NBP3-17878).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LIMD1 Antibody (NBP3-17878) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LIMD1 Products
Research Areas for LIMD1 Antibody (NBP3-17878)
Find related products by research area.
|
Blogs on LIMD1