We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

LIM Kinase 1 Recombinant Protein Antigen

Images

 
There are currently no images for LIM Kinase 1 Recombinant Protein Antigen (NBP3-17638PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LIM Kinase 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIM Kinase 1

Source: E. coli

Amino Acid Sequence: MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LIMK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17638.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LIM Kinase 1 Recombinant Protein Antigen

  • EC 2.7.11.1
  • LIM domain kinase 1
  • LIM Kinase 1
  • LIM motif-containing protein kinase
  • LIMK
  • LIMK1
  • LIMK-1
  • LIMKLIMK-1

Background

There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84843
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-85783
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-23411
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-56596
Species: Ca, Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-56159
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-85802
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA

Publications for LIM Kinase 1 Recombinant Protein Antigen (NBP3-17638PEP) (0)

There are no publications for LIM Kinase 1 Recombinant Protein Antigen (NBP3-17638PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIM Kinase 1 Recombinant Protein Antigen (NBP3-17638PEP) (0)

There are no reviews for LIM Kinase 1 Recombinant Protein Antigen (NBP3-17638PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LIM Kinase 1 Recombinant Protein Antigen (NBP3-17638PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LIM Kinase 1 Products

Research Areas for LIM Kinase 1 Recombinant Protein Antigen (NBP3-17638PEP)

Find related products by research area.

Blogs on LIM Kinase 1

There are no specific blogs for LIM Kinase 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LIM Kinase 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LIMK1