Lhx8 Antibody

Images

 
Western Blot: Lhx8 Antibody [NBP2-57782] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/ Immunofluorescence: Lhx8 Antibody [NBP2-57782] - Staining of human cell line A549 shows localization to nucleus, nucleoli & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lhx8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT
Specificity
Specificity of human Lhx8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LHX8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Lhx8 Recombinant Protein Antigen (NBP2-57782PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Lhx8 Antibody

  • LIM homeobox 8
  • LIM homeobox protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-526
Species: Hu
Applications: WB, IHC, IHC-P, IF
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NBP1-30052
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85445
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89481
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-88820
Species: Mu
Applications: WB
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-45525
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-46193
Species: Hu
Applications: WB, IHC
NBP1-80284
Species: Mu
Applications: WB
NBP2-57782
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for Lhx8 Antibody (NBP2-57782) (0)

There are no publications for Lhx8 Antibody (NBP2-57782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lhx8 Antibody (NBP2-57782) (0)

There are no reviews for Lhx8 Antibody (NBP2-57782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Lhx8 Antibody (NBP2-57782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Lhx8 Products

Array NBP2-57782

Bioinformatics Tool for Lhx8 Antibody (NBP2-57782)

Discover related pathways, diseases and genes to Lhx8 Antibody (NBP2-57782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lhx8 Antibody (NBP2-57782)

Discover more about diseases related to Lhx8 Antibody (NBP2-57782).
 

Pathways for Lhx8 Antibody (NBP2-57782)

View related products by pathway.

PTMs for Lhx8 Antibody (NBP2-57782)

Learn more about PTMs related to Lhx8 Antibody (NBP2-57782).

Blogs on Lhx8

There are no specific blogs for Lhx8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lhx8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LHX8