Lhx4 Antibody (1D6)

Images

 
Western Blot: Lhx4 Antibody (1D6) [H00089884-M15] - Analysis of LHX4 expression in human spleen.
Immunocytochemistry/ Immunofluorescence: Lhx4 Antibody (1D6) [H00089884-M15] - Analysis of monoclonal antibody to LHX4 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Lhx4 Antibody (1D6) [H00089884-M15] - Analysis of monoclonal antibody to LHX4 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
1D6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lhx4 Antibody (1D6) Summary

Immunogen
LHX4 (NP_203129, 291 a.a. ~ 390 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPF
Specificity
LHX4 (1D6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LHX4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against tissue lysate and recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lhx4 Antibody (1D6)

  • CPHD4
  • FLJ22769
  • Gsh4
  • LIM homeobox 4
  • LIM homeobox protein 4
  • LIM/homeobox protein Lhx4

Background

This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in control of differentiation and development of the pituitary gland. Mutations in this gene are associated with syndromic short stature and pituitary and hindbrain defects. An alternative splice variant has been described but its biological nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-84135
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92273
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP2-68688
Species: Hu
Applications: IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-90927
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
AF2569
Species: Hu
Applications: WB, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32252
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7388
Species: Hu
Applications: IHC
AF1979
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-68943
Species: Hu
Applications: IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1837
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-84310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-38770
Species: Hu, Mu
Applications: WB
AF3635
Species: Mu
Applications: WB, IHC

Publications for Lhx4 Antibody (H00089884-M15) (0)

There are no publications for Lhx4 Antibody (H00089884-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lhx4 Antibody (H00089884-M15) (0)

There are no reviews for Lhx4 Antibody (H00089884-M15). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Lhx4 Antibody (H00089884-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Lhx4 Products

Bioinformatics Tool for Lhx4 Antibody (H00089884-M15)

Discover related pathways, diseases and genes to Lhx4 Antibody (H00089884-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lhx4 Antibody (H00089884-M15)

Discover more about diseases related to Lhx4 Antibody (H00089884-M15).
 

Pathways for Lhx4 Antibody (H00089884-M15)

View related products by pathway.

PTMs for Lhx4 Antibody (H00089884-M15)

Learn more about PTMs related to Lhx4 Antibody (H00089884-M15).

Blogs on Lhx4

There are no specific blogs for Lhx4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lhx4 Antibody (1D6) and receive a gift card or discount.

Bioinformatics

Gene Symbol LHX4
Entrez
OMIM
Uniprot