Leupaxin Antibody - BSA Free

Western Blot: Leupaxin Antibody [NBP2-31078] - Analysis using Anti-LPXN antibody NBP2-31078 (A) shows similar pattern to independent antibody NBP2-55850 (B).

Immunohistochemistry-Paraffin: Leupaxin Antibody [NBP2-31078] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells, germinal center cells were moderately stained.

Western Blot: Leupaxin Antibody [NBP2-31078] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPXN antibody. Corresponding LPXN RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Leupaxin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSML
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPXN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Leupaxin Protein (NBP2-31078PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Leupaxin Antibody - BSA Free

• LDLP
• LDPL
• leupaxin

Background

The product encoded by this gene is preferentially expressed in hematopoietic cells and is most homologous to the focal adhesion protein, paxillin. It may function in cell type-specific signaling by associating with PYK2, a member of focal adhesion kinase family. As a substrate for a tyrosine kinase in lymphoid cells, this protein may also function in, and be regulated by tyrosine kinase activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LPXN