LETM1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LETM1 Antibody [NBP1-89556] - Staining of human cell line U-251 MG shows localization to mitochondria.

Analysis in human colon and pancreas tissues using Anti-LETM1 antibody. Corresponding LETM1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: LETM1 Antibody [NBP1-89556] - Staining of human colon shows high expression.

Immunohistochemistry-Paraffin: LETM1 Antibody [NBP1-89556] - Staining of human pancreas shows low expression as expected.

Simple Western: LETM1 Antibody [NBP1-89556] - Simple Western lane view shows a specific band for LETM1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: LETM1 Antibody [NBP1-89556] - Electropherogram image(s) of corresponding Simple Western lane view. LETM1 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Analysis in human cell line MOLT-4.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LETM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LETM1 Antibody - BSA Free (NBP1-89556) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-LETM1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LETM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 79 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  LETM1 Protein (NBP1-89556PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LETM1 Antibody - BSA Free

• LETM1 and EF-hand domain-containing protein 1, mitochondrial
• leucine zipper-EF-hand containing transmembrane protein 1
• Leucine zipper-EF-hand-containing transmembrane protein 1
• Mdm38 homolog

Background

The LETM1 gene encodes a protein that is localized to the inner mitochondrial membrane. The protein functions to maintain the mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations in this gene cause

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LETM1 Antibody (NBP1-89556)(1)

Publication using NBP1-89556

• Kuum M, Veksler V, Liiv J et al. Endoplasmic reticulum potassium-hydrogen exchanger and small conductance calcium-activated potassium channel activities are essential for ER calcium uptake in neurons and cardiomyocytes. J Cell Sci 2012-02-01 [PMID: 22331352]

Bioinformatics

• Gene Symbol: LETM1