LETM1 Antibody

Western Blot: LETM1 Antibody [NBP1-89556] - Analysis in human cell line MOLT-4.

Immunocytochemistry/Immunofluorescence: LETM1 Antibody [NBP1-89556] - Staining of human cell line U-251 MG shows localization to mitochondria.

Immunohistochemistry-Paraffin: LETM1 Antibody [NBP1-89556] - Staining in human colon and pancreas tissues using anti-LETM1 antibody. Corresponding LETM1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: LETM1 Antibody [NBP1-89556] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: LETM1 Antibody [NBP1-89556] - Staining of human colon shows high expression.

Immunohistochemistry-Paraffin: LETM1 Antibody [NBP1-89556] - Staining of human pancreas shows low expression as expected.

Simple Western: LETM1 Antibody [NBP1-89556] - Simple Western lane view shows a specific band for LETM1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: LETM1 Antibody [NBP1-89556] - Electropherogram image(s) of corresponding Simple Western lane view. LETM1 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

LETM1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLE
• Specificity: Specificity of human LETM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LETM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LETM1 Antibody

• LETM1 and EF-hand domain-containing protein 1, mitochondrial
• leucine zipper-EF-hand containing transmembrane protein 1
• Leucine zipper-EF-hand-containing transmembrane protein 1
• Mdm38 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LETM1 Antibody (NBP1-89556)(1)

Publication using NBP1-89556

• Kuum M, Veksler V, Liiv J et al. Endoplasmic reticulum potassium-hydrogen exchanger and small conductance calcium-activated potassium channel activities are essential for ER calcium uptake in neurons and cardiomyocytes. J Cell Sci 2012 Feb [PMID: 22331352]

Bioinformatics

• Gene Symbol: LETM1