LEPRE1 Antibody

Images

 
Western Blot: LEPRE1 Antibody [NBP2-30460] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry: LEPRE1 Antibody [NBP2-30460] - Staining of human vulva/anal skin shows positivity in fibroblasts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LEPRE1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: INKLEKAVAAAHTFFVGNPEHMEMQQNLDYYQTMSGVKEADFKDLETQPHMQEFRLGVRLYSEEQPQEAVPHLEAALQEYFVAYEECRALCEGPYDYDGYNYLEYNADLFQAITDHYIQVLNCKQNCVTELASHP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LEPRE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LEPRE1 Protein (NBP2-30460PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LEPRE1 Antibody

  • EC 1.14.11.7
  • GROS1OI8
  • Growth suppressor 1
  • leprecan
  • Leprecan-1
  • Leucine- and proline-enriched proteoglycan 1
  • leucine proline-enriched proteoglycan (leprecan) 1
  • MGC117314
  • P3H1LEPRECAN
  • prolyl 3-hydroxylase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94105
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-58529
Species: Hu
Applications: ICC/IF
NB600-408
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-97491
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7547
Species: Hu
Applications: WB, ICC
NBP1-94041
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NBP2-20119
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30460
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for LEPRE1 Antibody (NBP2-30460) (0)

There are no publications for LEPRE1 Antibody (NBP2-30460).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LEPRE1 Antibody (NBP2-30460) (0)

There are no reviews for LEPRE1 Antibody (NBP2-30460). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LEPRE1 Antibody (NBP2-30460) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LEPRE1 Products

Bioinformatics Tool for LEPRE1 Antibody (NBP2-30460)

Discover related pathways, diseases and genes to LEPRE1 Antibody (NBP2-30460). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEPRE1 Antibody (NBP2-30460)

Discover more about diseases related to LEPRE1 Antibody (NBP2-30460).
 

Pathways for LEPRE1 Antibody (NBP2-30460)

View related products by pathway.

PTMs for LEPRE1 Antibody (NBP2-30460)

Learn more about PTMs related to LEPRE1 Antibody (NBP2-30460).
 

Research Areas for LEPRE1 Antibody (NBP2-30460)

Find related products by research area.

Blogs on LEPRE1

There are no specific blogs for LEPRE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LEPRE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LEPRE1
Uniprot