Lefty1/2 Antibody (2Y10P2)

Western Blot: Lefty1/2 Antibody (2Y10P2) [NBP3-16118] - Western blot analysis of extracts of various cell lines, using Lefty1/2 Rabbit mAb (NBP3-16118) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: Lefty1/2 Antibody (2Y10P2) [NBP3-16118] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Lefty1/2 Rabbit mAb (NBP3-16118) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Western Blot: Lefty1/2 Antibody (2Y10P2) [NBP3-16118] - Western blot analysis of extracts of various cell lines, using Lefty1/2 Rabbit mAb (NBP3-16118) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 2Y10P2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Lefty1/2 Antibody (2Y10P2) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 267-366 of human Lefty1/2 (O75610). EMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: LEFTY2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lefty1/2 Antibody (2Y10P2)

• Beta-4 (Endometrial Bleeding-Associated Factor; LEFTY A)
• EBAF
• endometrial bleeding associated factor (left-right determination
• Endometrial Bleeding Associated Factor (Left-Right Determination, Factor A;
• Endometrial Bleeding-Associated Factor
• LEFTA
• Left-Right Determination Factor 2
• Left-Right Determination Factor A
• LEFTY2
• LEFTYA
• Protein Lefty-2
• Protein Lefty-A
• TGFB4
• TGF-beta-4
• Transforming Growth Factor Beta-4
• Transforming Growth Factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LEFTY2