Recombinant Human LEF1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human LEF1 Protein [H00051176-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human LEF1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 14-123 of Human LEF1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNND

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
LEF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LEF1 GST (N-Term) Protein

  • DKFZp586H0919
  • FLJ46390
  • LEF1
  • LEF-1
  • lymphoid enhancer-binding factor 1
  • T cell-specific transcription factor 1-alpha
  • TCF10
  • TCF1ALPHA
  • TCF1-alpha
  • TCF7L3

Background

LEF1 - lymphoid enhancer-binding factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF5596
Species: Hu
Applications: ICC, IHC, WB
NBP2-67618
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF6116
Species: Hu
Applications: ICC, WB
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-24695
Species: Hu
Applications: IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
5036-WN/CF
Species: Hu
Applications: BA, BA
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB7650
Species: Mu
Applications: IHC, WB
H00051176-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for LEF1 Partial Recombinant Protein (H00051176-Q01) (0)

There are no publications for LEF1 Partial Recombinant Protein (H00051176-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LEF1 Partial Recombinant Protein (H00051176-Q01) (0)

There are no reviews for LEF1 Partial Recombinant Protein (H00051176-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LEF1 Partial Recombinant Protein (H00051176-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LEF1 Products

Bioinformatics Tool for LEF1 Partial Recombinant Protein (H00051176-Q01)

Discover related pathways, diseases and genes to LEF1 Partial Recombinant Protein (H00051176-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEF1 Partial Recombinant Protein (H00051176-Q01)

Discover more about diseases related to LEF1 Partial Recombinant Protein (H00051176-Q01).
 

Pathways for LEF1 Partial Recombinant Protein (H00051176-Q01)

View related products by pathway.

PTMs for LEF1 Partial Recombinant Protein (H00051176-Q01)

Learn more about PTMs related to LEF1 Partial Recombinant Protein (H00051176-Q01).
 

Research Areas for LEF1 Partial Recombinant Protein (H00051176-Q01)

Find related products by research area.

Blogs on LEF1.

The role of Wnts in neuroinflammation
By Michalina Hanzel, PhDThe multifaceted roles of the Wnt family of glycoproteins have been extensively characterized throughout embryonic development and adult homeostasis. The highly conserved, cell- and tissue- s...  Read full blog post.

Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LEF1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LEF1