Recombinant Human LEF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LEF1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 14-123 of Human LEF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNND

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
LEF1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LEF1 Protein

  • DKFZp586H0919
  • FLJ46390
  • LEF1
  • LEF-1
  • lymphoid enhancer-binding factor 1
  • T cell-specific transcription factor 1-alpha
  • TCF10
  • TCF1ALPHA
  • TCF1-alpha
  • TCF7L3

Background

LEF1 - lymphoid enhancer-binding factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF5596
Species: Hu
Applications: WB, IHC, ICC
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF1620
Species: Mu
Applications: WB, IHC
AF3287
Species: Hu, Mu, Rt
Applications: WB
AF4885
Species: Mu
Applications: WB, IP
MAB7650
Species: Mu
Applications: WB, IHC
H00051176-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for LEF1 Partial Recombinant Protein (H00051176-Q01) (0)

There are no publications for LEF1 Partial Recombinant Protein (H00051176-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LEF1 Partial Recombinant Protein (H00051176-Q01) (0)

There are no reviews for LEF1 Partial Recombinant Protein (H00051176-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LEF1 Partial Recombinant Protein (H00051176-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LEF1 Products

Bioinformatics Tool for LEF1 Partial Recombinant Protein (H00051176-Q01)

Discover related pathways, diseases and genes to LEF1 Partial Recombinant Protein (H00051176-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEF1 Partial Recombinant Protein (H00051176-Q01)

Discover more about diseases related to LEF1 Partial Recombinant Protein (H00051176-Q01).
 

Pathways for LEF1 Partial Recombinant Protein (H00051176-Q01)

View related products by pathway.

PTMs for LEF1 Partial Recombinant Protein (H00051176-Q01)

Learn more about PTMs related to LEF1 Partial Recombinant Protein (H00051176-Q01).
 

Research Areas for LEF1 Partial Recombinant Protein (H00051176-Q01)

Find related products by research area.

Blogs on LEF1.

Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.

Customers Who Bought This Also Bought

LEF1 Antibody
NBP1-86960
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LEF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LEF1
Entrez