LDB3 Antibody


Western Blot: LDB3 Antibody [NBP1-54998] - Titration: 0.625ug/ml Positive Control: Human heart.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

LDB3 Antibody Summary

Synthetic peptides corresponding to LDB3(LIM domain binding 3) The peptide sequence was selected from the N terminal of LDB3. Peptide sequence PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LDB3 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-54998 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LDB3 Antibody

  • CMD1C
  • KIAA01613
  • KIAA0613FLJ35865
  • LDB3Z1
  • LDB3Z4
  • LIM domain binding 3
  • LIM domain-binding protein 3
  • PDLIM6
  • PDZ and LIM domain 6
  • Protein cypher
  • Z-band alternatively spliced PDZ-motif protein


LDB3 may function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, ELISA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB

Publications for LDB3 Antibody (NBP1-54998)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for LDB3 Antibody (NBP1-54998) (0)

There are no reviews for LDB3 Antibody (NBP1-54998). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LDB3 Antibody (NBP1-54998) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LDB3 Products

Bioinformatics Tool for LDB3 Antibody (NBP1-54998)

Discover related pathways, diseases and genes to LDB3 Antibody (NBP1-54998). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LDB3 Antibody (NBP1-54998)

Discover more about diseases related to LDB3 Antibody (NBP1-54998).

Pathways for LDB3 Antibody (NBP1-54998)

View related products by pathway.

PTMs for LDB3 Antibody (NBP1-54998)

Learn more about PTMs related to LDB3 Antibody (NBP1-54998).

Blogs on LDB3

There are no specific blogs for LDB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LDB3 Antibody and receive a gift card or discount.


Gene Symbol LDB3