LDB3 Antibody

Images

 
Western Blot: LDB3 Antibody [NBP1-54998] - Titration: 0.625ug/ml Positive Control: Human heart.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LDB3 Antibody Summary

Immunogen
Synthetic peptides corresponding to LDB3(LIM domain binding 3) The peptide sequence was selected from the N terminal of LDB3. Peptide sequence PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LDB3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LDB3 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-54998 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LDB3 Antibody

  • CMD1C
  • CYPHER
  • KIAA01613
  • KIAA0613FLJ35865
  • LDB3Z1
  • LDB3Z4
  • LIM domain binding 3
  • LIM domain-binding protein 3
  • ORACLE
  • PDLIM6
  • PDZ and LIM domain 6
  • Protein cypher
  • ZASPLVNC3
  • Z-band alternatively spliced PDZ-motif protein

Background

LDB3 may function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00006901-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-85439
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
H00009124-D01P
Species: Hu
Applications: WB, ELISA
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-54998
Species: Hu
Applications: WB

Publications for LDB3 Antibody (NBP1-54998)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for LDB3 Antibody (NBP1-54998) (0)

There are no reviews for LDB3 Antibody (NBP1-54998). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LDB3 Antibody (NBP1-54998) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LDB3 Products

Bioinformatics Tool for LDB3 Antibody (NBP1-54998)

Discover related pathways, diseases and genes to LDB3 Antibody (NBP1-54998). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LDB3 Antibody (NBP1-54998)

Discover more about diseases related to LDB3 Antibody (NBP1-54998).
 

Pathways for LDB3 Antibody (NBP1-54998)

View related products by pathway.

PTMs for LDB3 Antibody (NBP1-54998)

Learn more about PTMs related to LDB3 Antibody (NBP1-54998).

Blogs on LDB3

There are no specific blogs for LDB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LDB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LDB3
Uniprot