LCLAT1 Antibody

Images

 
Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP2-14187] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LCLAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKSHFEDMIDYFCDIHEPL QLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCLAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LCLAT1 Protein (NBP2-14187PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LCLAT1 Antibody

  • 1-acylglycerol-3-phosphate O-acyltransferase 8
  • 1-AGPAT 8
  • Acyl-CoA:lysocardiolipin acyltransferase 1
  • AGPAT8lysocardiolipin acyltransferase
  • ALCAT11AGPAT8
  • EC 2.3.1.-
  • EC 2.3.1.51
  • FLJ37965
  • HSRG1849
  • LYCAT
  • lysocardiolipin acyltransferase 1
  • UNQ1849,1-AGP acyltransferase 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009056-B01P
Species: Hu, Rt
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-51841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83929
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-04299
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-14187
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for LCLAT1 Antibody (NBP2-14187) (0)

There are no publications for LCLAT1 Antibody (NBP2-14187).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCLAT1 Antibody (NBP2-14187) (0)

There are no reviews for LCLAT1 Antibody (NBP2-14187). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LCLAT1 Antibody (NBP2-14187) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LCLAT1 Products

Bioinformatics Tool for LCLAT1 Antibody (NBP2-14187)

Discover related pathways, diseases and genes to LCLAT1 Antibody (NBP2-14187). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LCLAT1

There are no specific blogs for LCLAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LCLAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCLAT1