New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

LBX1 Antibody (3G6)

Images

 
Western Blot: LBX1 Antibody (3G6) [H00010660-M05] - Detection against Immunogen (35.2 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LBX1 Antibody (3G6) Summary

Immunogen
LBX1 (NP_006553.2, 133 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATA
Specificity
LBX1 (3G6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LBX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LBX1 Antibody (3G6)

  • homeobox
  • HPX6
  • HPX-6
  • ladybird homeobox 1
  • ladybird homeobox homolog 1 (Drosophila)
  • ladybird homeobox homolog 1
  • Ladybird homeobox protein homolog 1
  • LBX1Hlady bird-like homeobox
  • transcription factor LBX1
  • transcription factor similar to D. melanogaster homeodomain protein lady birdlate

Background

This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2457
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
AF276
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, WB
294-HG/CF
Species: Hu
Applications: BA
MAB1675
Species: Ch, Hu, Mu, Rt
Applications: ICC, IHC
AF7388
Species: Hu
Applications: IHC
AF3364
Species: Hu
Applications: ICC, IHC, WB
H00085474-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
H00030012-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
D6050
Species: Hu
Applications: ELISA
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NBP2-14013
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00004223-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00010660-M05
Species: Hu
Applications: WB, ELISA

Publications for LBX1 Antibody (H00010660-M05) (0)

There are no publications for LBX1 Antibody (H00010660-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LBX1 Antibody (H00010660-M05) (0)

There are no reviews for LBX1 Antibody (H00010660-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LBX1 Antibody (H00010660-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LBX1 Products

Array H00010660-M05

Bioinformatics Tool for LBX1 Antibody (H00010660-M05)

Discover related pathways, diseases and genes to LBX1 Antibody (H00010660-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LBX1 Antibody (H00010660-M05)

Discover more about diseases related to LBX1 Antibody (H00010660-M05).
 

Pathways for LBX1 Antibody (H00010660-M05)

View related products by pathway.

PTMs for LBX1 Antibody (H00010660-M05)

Learn more about PTMs related to LBX1 Antibody (H00010660-M05).

Blogs on LBX1

There are no specific blogs for LBX1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LBX1 Antibody (3G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol LBX1
Entrez
OMIM
Uniprot