LBX2 Antibody (3A5)

Images

 
Western Blot: LBX2 Antibody (3A5) [H00085474-M02] - Analysis of LBX2 expression in transfected 293T cell line by LBX2 monoclonal antibody (M02), clone 3A5.Lane 1: LBX2 transfected lysate (Predicted MW: 21.4 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: LBX2 Antibody (3A5) [H00085474-M02] - Analysis of monoclonal antibody to LBX2 on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: LBX2 Antibody (3A5) [H00085474-M02] - Detection limit for recombinant GST tagged LBX2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
3A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LBX2 Antibody (3A5) Summary

Immunogen
LBX2 (NP_001009812.1, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD
Specificity
LBX2 - ladybird homeobox homolog 2 (Drosophila) (3A5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LBX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LBX2 Antibody (3A5)

  • lady bird-like homeobox 2
  • ladybird homeobox 2
  • ladybird homeobox homolog 2 (Drosophila)
  • ladybird homeobox homolog 2
  • Ladybird homeobox protein homolog 2
  • ladybird-like homeobox 2
  • ladybird-like homeodomain protein 2
  • transcription factor LBX2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010660-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-85889
Species: Hu
Applications: WB
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-13795
Species: Hu
Applications: IHC, IHC-P
NBP1-81867
Species: Hu
Applications: IHC, IHC-P
H00002019-M04
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13734
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AF2444
Species: Hu
Applications: IHC, WB
NBP2-47404
Species: Hu
Applications: IHC, IHC-P
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
7347-WN/CF
Species: Hu
Applications: BA
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NBP1-32682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for LBX2 Antibody (H00085474-M02) (0)

There are no publications for LBX2 Antibody (H00085474-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LBX2 Antibody (H00085474-M02) (0)

There are no reviews for LBX2 Antibody (H00085474-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LBX2 Antibody (H00085474-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LBX2 Products

Array H00085474-M02

Bioinformatics Tool for LBX2 Antibody (H00085474-M02)

Discover related pathways, diseases and genes to LBX2 Antibody (H00085474-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LBX2 Antibody (H00085474-M02)

Discover more about diseases related to LBX2 Antibody (H00085474-M02).
 

Pathways for LBX2 Antibody (H00085474-M02)

View related products by pathway.

PTMs for LBX2 Antibody (H00085474-M02)

Learn more about PTMs related to LBX2 Antibody (H00085474-M02).

Blogs on LBX2

There are no specific blogs for LBX2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LBX2 Antibody (3A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol LBX2
Entrez
Uniprot