LBP Recombinant Protein Antigen

Images

 
There are currently no images for LBP Protein (NBP1-88371PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LBP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LBP.

Source: E. coli

Amino Acid Sequence: EGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLEALLNYYI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LBP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88371.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LBP Recombinant Protein Antigen

  • LBP
  • lipopolysaccharide binding protein
  • lipopolysaccharide-binding protein
  • LPS-binding protein
  • MGC22233

Background

The protein encoded by the LBP gene is involved in the acute-phase immunologic response to gram-negative bacterialinfections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Togetherwith bactericidal permeability-increasing protein (BPI), the encoded protein binds LPS and interacts with the CD14receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that theencoded protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS fromcirculation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasmacholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP). Finally, this gene is found onchromosome 20, immediately downstream of the BPI gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DC140
Species: Hu
Applications: ELISA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
M6000B
Species: Mu
Applications: ELISA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
7468-BP
Species: Hu
Applications: BA
DY1707
Species: Hu
Applications: ELISA
1787-MD
Species: Hu
Applications: Bind
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
DY417
Species: Mu
Applications: ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
201-LB
Species: Hu
Applications: BA
DHAPG0
Species: Hu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for LBP Protein (NBP1-88371PEP) (0)

There are no publications for LBP Protein (NBP1-88371PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LBP Protein (NBP1-88371PEP) (0)

There are no reviews for LBP Protein (NBP1-88371PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LBP Protein (NBP1-88371PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LBP Products

Research Areas for LBP Protein (NBP1-88371PEP)

Find related products by research area.

Blogs on LBP

There are no specific blogs for LBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LBP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LBP