| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 5I10Q5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit LATS1 Antibody (5I10Q5) (NBP3-33348) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LATS1 (NP_004681.1). Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | LATS1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 127 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LATS1 Antibody (NBP3-33348)Find related products by research area.
|
|
TAZ Antibody: The Devil is in the Details WW domain-containing transcription regulator protein 1 also known as WWTR1 and TAZ, is a 44KDa protein that acts as a downstream regulatory target in the Hippo signaling pathway. This protein undergoes post-translational modification and becomes phosp... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LATS1 |