Latrophilin 1/LPHN1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLP |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADGRL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Latrophilin 1/LPHN1 Antibody - BSA Free
Background
Latrophilin-1 is a brain-specific Orphan-B Receptor that binds alpha-latrotoxin, a potent presynaptic neurotoxin present in the venom of the black widow spider, in a Ca2+-independent manner. As with the other two latrophilins, it shares homology with lectin, olfactomedin, and transmembrane domains, and possesses variable C-termini and various alternative-splicing sites. CIRL is endogenously cleaved into two pieces at the GPCR proteolytic site (GPS) located adjacent to the first transmembrane helix as a mechanism to compartmentalize the cell adhesion and GPCR activation functions. Latrophilin-1 has been reported to be expressed predominantly in the brain. Very weak expression has also been documented in human heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. ESTs have been isolated from brain, eye, kidney, lung, and lymph node libraries. In addition, ESTs have been isolated from the following cancer libraries: brain, choriocarcinoma, epithelioid carcinoma, kidney, and lung.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Mu
Applications: ELISA
Species: Fe, Hu, RM
Applications: BA, BA
Publications for Latrophilin 1/LPHN1 Antibody (NBP1-85609) (0)
There are no publications for Latrophilin 1/LPHN1 Antibody (NBP1-85609).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Latrophilin 1/LPHN1 Antibody (NBP1-85609) (0)
There are no reviews for Latrophilin 1/LPHN1 Antibody (NBP1-85609).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Latrophilin 1/LPHN1 Antibody (NBP1-85609) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Latrophilin 1/LPHN1 Products
Research Areas for Latrophilin 1/LPHN1 Antibody (NBP1-85609)
Find related products by research area.
|
Blogs on Latrophilin 1/LPHN1