Latrophilin 1/LPHN1 Antibody

Images

 
Immunohistochemistry: Latrophilin 1/LPHN1 Antibody [NBP1-85609] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Latrophilin 1/LPHN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPHN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Latrophilin 1/LPHN1 Protein (NBP1-85609PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Latrophilin 1/LPHN1 Antibody

  • Calcium-independent alpha-latrotoxin receptor 1
  • CIRL1
  • CIRL-1
  • KIAA0821
  • Latrophilin 1
  • latrophilin-1
  • LEC2
  • LEC2CL1
  • Lectomedin-2
  • LPHN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58704
Species: Hu
Applications: WB, ICC/IF
NBP1-77128
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-76949
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-30583
Species: Hu
Applications: WB, IHC, IHC-P
NLS1138
Species: Hu, Mu, Rt, Bt, Ch, Eq, Mk, Pm, Rb
Applications: IHC, IHC-P
NBL1-16115
Species: Hu
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7035
Species: Hu
Applications: IHC
NBP1-85609
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Latrophilin 1/LPHN1 Antibody (NBP1-85609) (0)

There are no publications for Latrophilin 1/LPHN1 Antibody (NBP1-85609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Latrophilin 1/LPHN1 Antibody (NBP1-85609) (0)

There are no reviews for Latrophilin 1/LPHN1 Antibody (NBP1-85609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Latrophilin 1/LPHN1 Antibody (NBP1-85609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Latrophilin 1/LPHN1 Products

Bioinformatics Tool for Latrophilin 1/LPHN1 Antibody (NBP1-85609)

Discover related pathways, diseases and genes to Latrophilin 1/LPHN1 Antibody (NBP1-85609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Latrophilin 1/LPHN1 Antibody (NBP1-85609)

Discover more about diseases related to Latrophilin 1/LPHN1 Antibody (NBP1-85609).
 

Pathways for Latrophilin 1/LPHN1 Antibody (NBP1-85609)

View related products by pathway.

PTMs for Latrophilin 1/LPHN1 Antibody (NBP1-85609)

Learn more about PTMs related to Latrophilin 1/LPHN1 Antibody (NBP1-85609).
 

Research Areas for Latrophilin 1/LPHN1 Antibody (NBP1-85609)

Find related products by research area.

Blogs on Latrophilin 1/LPHN1

There are no specific blogs for Latrophilin 1/LPHN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Latrophilin 1/LPHN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPHN1
Entrez