Latent TGF-beta bp2/LTBP-2 Antibody (5D7)

Images

 
Sandwich ELISA: Latent TGF-beta bp2/LTBP-2 Antibody (5D7) [H00004053-M01] - Detection limit for recombinant GST tagged LTBP2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Latent TGF-beta bp2/LTBP-2 Antibody (5D7) Summary

Immunogen
LTBP2 (NP_000419 1709 a.a. - 1818 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCT
Specificity
LTBP2 - latent transforming growth factor beta binding protein 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LTBP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Latent TGF-beta bp2/LTBP-2 Antibody (5D7)

  • C14orf141
  • GLC3D
  • Latent TGFbeta bp2
  • Latent TGF-beta bp2
  • latent transforming growth factor beta binding protein 2
  • latent-transforming growth factor beta-binding protein 2
  • LTBP2
  • LTBP-2
  • LTBP3chromosome 14 open reading frame 141
  • MSTP031

Background

The protein encoded by this gene belongs to the family of latent transforming growth factor (TGF)-beta binding proteins (LTBP), which are extracellular matrix proteins with multi-domain structure. This protein is the largest member of the LTBP family possessing unique regions and with most similarity to the fibrillins. It has thus been suggested that it may have multiple functions: as a member of the TGF-beta latent complex, as a structural component of microfibrils, and a role in cell adhesion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB388
Species: Hu
Applications: WB, AP
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
MAB3095
Species: Hu
Applications: WB, IHC
AF4977
Species: Mu
Applications: WB
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
H00004053-M01
Species: Hu
Applications: WB, ELISA

Publications for Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01) (0)

There are no publications for Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01) (0)

There are no reviews for Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Latent TGF-beta bp2/LTBP-2 Products

Bioinformatics Tool for Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01)

Discover related pathways, diseases and genes to Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01)

Discover more about diseases related to Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01).
 

Pathways for Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01)

View related products by pathway.

PTMs for Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01)

Learn more about PTMs related to Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01).
 

Research Areas for Latent TGF-beta bp2/LTBP-2 Antibody (H00004053-M01)

Find related products by research area.

Blogs on Latent TGF-beta bp2/LTBP-2

There are no specific blogs for Latent TGF-beta bp2/LTBP-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Latent TGF-beta bp2/LTBP-2 Antibody (5D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol LTBP2
Entrez
OMIM
Uniprot