LASS2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN |
| Predicted Species |
Mouse (91%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CERS2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for LASS2 Antibody - BSA Free
Background
LASS2 encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: AdBlk, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for LASS2 Antibody (NBP3-17730) (0)
There are no publications for LASS2 Antibody (NBP3-17730).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LASS2 Antibody (NBP3-17730) (0)
There are no reviews for LASS2 Antibody (NBP3-17730).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for LASS2 Antibody (NBP3-17730) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LASS2 Products
Blogs on LASS2