LASP1 Antibody - BSA Free

Western Blot: LASP1 Antibody [NBP3-38061] - Western blot analysis of various lysates using LASP1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: LASP1 Antibody [NBP3-38061] - Immunofluorescence analysis of U-2 OS cells using LASP1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation: LASP1 Antibody [NBP3-38061] - Immunoprecipitation analysis of 300 ug extracts of A-549 cells using 3 ug LASP1 antibody. Western blot was performed from the immunoprecipitate using LASP1 antibody at a dilution of 1:1000.

Immunocytochemistry/ Immunofluorescence: LASP1 Antibody [NBP3-38061] - Immunofluorescence analysis of L929 cells using LASP1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: LASP1 Antibody [NBP3-38061] - Immunofluorescence analysis of C6 cells using LASP1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LASP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LASP1 Antibody - BSA Free (NBP3-38061) is a polyclonal antibody validated for use in WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1).
  
  Sequence:
  RMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LASP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:1000 - 1:3000
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LASP1 Antibody - BSA Free

• LASP-1
• LIM and SH3 domain protein 1
• LIM and SH3 protein 1
• Metastatic lymph node gene 50 protein
• MLN 50
• MLN50Lasp-1

Background

LASP1 functions as an actin-binding protein and possibly in cytoskeletal organization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LASP1