Lano Antibody

Images

 
Western Blot: Lano Antibody [NBP1-88016] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Lano Antibody [NBP1-88016] - Staining of human kidney shows moderate basolateral membrane positivity mainly in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lano Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NERAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRNDMNAAKGLDSNKNEVNHAIDRVTT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lano Protein (NBP1-88016PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lano Antibody

  • dJ523E19.1
  • FLJ10775
  • FLJ11834
  • LANOLANO adapter protein
  • LAP (leucine-rich repeats and PDZ) and no PDZ protein
  • LAP and no PDZ protein
  • leucine rich repeat containing 1
  • leucine-rich repeat-containing 1
  • leucine-rich repeat-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00009697-M03
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84425
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00053405-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-56507
Species: Hu
Applications: ICC/IF
NBP2-38245
Species: Hu
Applications: IHC, IHC-P
H00008521-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-80330
Species: Hu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
BC110-60480
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88016
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Lano Antibody (NBP1-88016) (0)

There are no publications for Lano Antibody (NBP1-88016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lano Antibody (NBP1-88016) (0)

There are no reviews for Lano Antibody (NBP1-88016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lano Antibody (NBP1-88016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lano Products

Bioinformatics Tool for Lano Antibody (NBP1-88016)

Discover related pathways, diseases and genes to Lano Antibody (NBP1-88016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lano Antibody (NBP1-88016)

Discover more about diseases related to Lano Antibody (NBP1-88016).
 

Pathways for Lano Antibody (NBP1-88016)

View related products by pathway.

Blogs on Lano

There are no specific blogs for Lano, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lano Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC1