Lano Antibody - BSA Free

Analysis in human rectum and lymph node tissues using Anti-LRRC1 antibody. Corresponding LRRC1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Lano Antibody [NBP1-88016] - Staining of human rectum shows high expression.

Immunohistochemistry-Paraffin: Lano Antibody [NBP1-88016] - Staining of human lymph node shows low expression as expected.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Lano Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Lano Antibody - BSA Free (NBP1-88016) is a polyclonal antibody validated for use in IHC and WB. Anti-Lano Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NERAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRNDMNAAKGLDSNKNEVNHAIDRVTT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Lano Protein (NBP1-88016PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lano Antibody - BSA Free

• dJ523E19.1
• FLJ10775
• FLJ11834
• LANO
• LANOLANO adapter protein
• LAP (leucine-rich repeats and PDZ) and no PDZ protein
• LAP and no PDZ protein
• leucine rich repeat containing 1
• leucine-rich repeat-containing 1
• leucine-rich repeat-containing protein 1
• LRRC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Lano Antibody (NBP1-88016)(1)

Publication using NBP1-88016

• Choi J, Troyanovsky RB, Indra I et al. Scribble, Erbin, and Lano redundantly regulate epithelial polarity and apical adhesion complex J. Cell Biol. 2019-07-01 [PMID: 31147384]

Bioinformatics

• Gene Symbol: LRRC1