TRAM2 Antibody (3G6)

Immunohistochemistry-Paraffin: TRAM2 Antibody (3G6) [H00009697-M03] - Analysis of monoclonal antibody to TRAM2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml

Sandwich ELISA: TRAM2 Antibody (3G6) [H00009697-M03] - Detection limit for recombinant GST tagged TRAM2 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC, IHC-P, S-ELISA
• Clone: 3G6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

TRAM2 Antibody (3G6) Summary

• Immunogen: TRAM2 (NP_036420, 310 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSPRTKKLKS
• Specificity: Reacts with translocation associated membrane protein 2.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TRAM2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRAM2 Antibody (3G6)

• KIAA0057TRAM-like protein
• translocating chain-associated membrane protein 2
• translocation associated membrane protein 2

Background

TRAM2 is a component of the translocon, a gated macromolecular channel that controls the posttranslational processing of nascent secretory and membrane proteins at the endoplasmic reticulum (ER) membrane.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRAM2
• Entrez:
  • 9697(Human)
• Uniprot:
  • NP_036420(Human)