Laminin S/Laminin beta 2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAMB2. Source: E. coli
Amino Acid Sequence: DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
LAMB2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87717. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Laminin S/Laminin beta 2 Recombinant Protein Antigen
Background
The Laminins comprise a growing family of disulfide-linked heterotrimers consisting of three genetically distinct polypeptide chains, designated alpha, beta and gamma. A major component of the basal lamina, Laminins play a crucial role in providing a scaffolding upon which tissues are assembled and which serves as a physical barrier separating specialized tissues. During embryogenesis and early development, cells migrate along basement membranes, which are required for the polarization of cells. The beta-2 laminin chain plays a role in melanoma spread, promoting tumor migration along the abluminal surface of vessel, a phenomenon which has been termed extra-vascular migratory metastasis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, mIF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, Neut, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, KO, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Rt
Applications: BA, BA
Species: Hu
Applications: AC
Publications for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP) (0)
There are no publications for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP) (0)
There are no reviews for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP) (0)
Additional Laminin S/Laminin beta 2 Products
Blogs on Laminin S/Laminin beta 2