Laminin S/Laminin beta 2 Recombinant Protein Antigen

Images

 
There are currently no images for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Laminin S/Laminin beta 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAMB2.

Source: E.coli

Amino Acid Sequence: DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG

Protein/Peptide Type
Recombinant Protein Antigen
Gene
LAMB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87717.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Laminin S/Laminin beta 2 Recombinant Protein Antigen

  • LAMB2
  • Laminin B1s chain
  • Laminin beta 2
  • Laminin S
  • laminin subunit beta-2
  • laminin, beta 2 (laminin S)
  • Laminin-11 subunit beta
  • Laminin-14 subunit beta
  • Laminin-15 subunit beta
  • Laminin-3 subunit beta
  • Laminin-4 subunit beta
  • Laminin-7 subunit beta
  • LAMSLaminin-9 subunit beta
  • S-LAM beta
  • S-laminin subunit beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3159
Species: Mu
Applications: WB, IHC
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1265
Species: Mu
Applications: WB, IP, Neut
NBP1-92275
Species: Hu
Applications: IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005542-R06
Species: Hu
MAB4077
Species: Hu
Applications: WB, IHC
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP) (0)

There are no publications for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP) (0)

There are no reviews for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Laminin S/Laminin beta 2 Products

Bioinformatics Tool for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP)

Discover related pathways, diseases and genes to Laminin S/Laminin beta 2 Protein (NBP1-87717PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP)

Discover more about diseases related to Laminin S/Laminin beta 2 Protein (NBP1-87717PEP).
 

Pathways for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP)

View related products by pathway.

PTMs for Laminin S/Laminin beta 2 Protein (NBP1-87717PEP)

Learn more about PTMs related to Laminin S/Laminin beta 2 Protein (NBP1-87717PEP).

Blogs on Laminin S/Laminin beta 2

There are no specific blogs for Laminin S/Laminin beta 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Reg3A Antibody
NBP2-24763
Reg3A Antibody
NBP2-24763

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Laminin S/Laminin beta 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMB2
Entrez