Recombinant Human Laminin alpha 5 GST (N-Term) Protein

SDS-Page: Recombinant Human Laminin alpha 5 Protein [H00003911-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human Laminin alpha 5 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human Laminin alpha 5
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFTPPPLLRFP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: LAMA5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Laminin alpha 5 GST (N-Term) Protein

• KIAA0533
• KIAA1907
• laminin alpha-5 chain
• laminin subunit alpha-5
• laminin, alpha 5
• Laminin-10 subunit alpha
• Laminin-11 subunit alpha
• Laminin-15 subunit alpha

Background

Components of the extracellular matrix exert myriad effects on tissues throughout the body. In particular, the laminins, a family of heterotrimeric extracellular glycoproteins, affect tissue development and integrity in such diverse organs as the kidney, lung, skin, and nervous system. It is thought that laminins mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Laminins function as heterotrimeric complexes of alpha, beta, and gamma chains, with each chain type representing a different subfamily of proteins. The protein encoded by this gene belongs to the alpha subfamily of laminin chains and is a major component of basement membranes. Two transcript variants encoding different isoforms have been found for this gene, but the full-length nature of one of them has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Laminin alpha 5 Partial Recombinant Protein (H00003911-Q01)(1)

Publication using H00003911-Q01

• Karina Vargas-Sanchez, Monica Losada-Barragán, Maria Mogilevskaya, Susana Novoa-Herrán, Yehidi Medina, Cristian Buendía-Atencio, Vaneza Lorett-Velásquez, Jessica Martínez-Bernal, Rodrigo E. Gonzalez-Reyes, David Ramírez, Klaus G. Petry, Fabrizio Michetti Screening for Interacting Proteins with Peptide Biomarker of Blood–Brain Barrier Alteration under Inflammatory Conditions International Journal of Molecular Sciences 2021-04-29 [PMID: 33946948]

Bioinformatics

• Gene Symbol: LAMA5