Laminin alpha 3 Recombinant Protein Antigen

Images

 
There are currently no images for Laminin alpha 3 Recombinant Protein Antigen (NBP2-42390PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Laminin alpha 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAMA3.

Source: E. coli

Amino Acid Sequence: LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LAMA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-42390.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Laminin alpha 3 Recombinant Protein Antigen

  • BM600 150kD subunit
  • BM600
  • BM600-150kDa
  • E170
  • Epiligrin 170 kDa subunit
  • epiligrin alpha 3 subunit
  • Epiligrin subunit alpha
  • epiligrin
  • kalinin 165kD subunit
  • Kalinin subunit alpha
  • kalinin-165kDa
  • lama3a
  • laminin subunit alpha-3
  • laminin, alpha 3 (nicein (150kD), kalinin (165kD), BM600 (150kD), epilegrin)
  • laminin, alpha 3
  • laminin-5 alpha 3 chain
  • Laminin-5 subunit alpha
  • Laminin-6 subunit alpha
  • Laminin-7 subunit alpha
  • LAMNA
  • LOCS
  • nicein 150kD subunit
  • Nicein subunit alpha
  • nicein-150kDa

Background

Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. The protein encoded by this gene is the alpha-3 subunit of laminin 5, which is a complex glycoprotein composed of three subunits (alpha, beta, and gamma). Laminin 5 is thought to be involved in cell adhesion, signal transduction and differentiation of keratinocytes. Mutations in this gene have been identified as the cause of Herlitz type junctional epidermolysis bullosa. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-46622
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
664-LI
Species: Hu
Applications: BA
DKK300
Species: Hu
Applications: ELISA
NBP1-91800
Species: Hu
Applications: IHC,  IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
AF3468
Species: Hu
Applications: ICC, KO, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
AF4036
Species: Hu
Applications: Simple Western, WB
DSHBG0B
Species: Hu
Applications: ELISA
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
5609-MU
Species: Hu
Applications: Bind
H00065057-M02
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
MAB41281
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-42390PEP
Species: Hu
Applications: AC

Publications for Laminin alpha 3 Recombinant Protein Antigen (NBP2-42390PEP) (0)

There are no publications for Laminin alpha 3 Recombinant Protein Antigen (NBP2-42390PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin alpha 3 Recombinant Protein Antigen (NBP2-42390PEP) (0)

There are no reviews for Laminin alpha 3 Recombinant Protein Antigen (NBP2-42390PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Laminin alpha 3 Recombinant Protein Antigen (NBP2-42390PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Laminin alpha 3 Products

Research Areas for Laminin alpha 3 Recombinant Protein Antigen (NBP2-42390PEP)

Find related products by research area.

Blogs on Laminin alpha 3

There are no specific blogs for Laminin alpha 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Laminin alpha 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMA3