Laminin alpha 2 Antibody (1A7)

Images

 
There are currently no images for Laminin alpha 2 Antibody (H00003908-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Laminin alpha 2 Antibody (1A7) Summary

Immunogen
LAMA2 (NP_000417 3013 a.a. - 3122 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LAMA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Laminin alpha 2 Antibody (1A7)

  • Laminin M chain
  • laminin subunit alpha-2
  • laminin, alpha 2
  • Laminin-12 subunit alpha
  • Laminin-2 subunit alpha
  • LAMMLaminin-4 subunit alpha
  • Merosin heavy chain

Background

Laminin, an extracellular protein, is a major component of the basement membrane. It is thought to mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. It is composed of three subunits, alpha, beta, and gamma, which are bound to each other by disulfide bonds into a cross-shaped molecule. This gene encodes the alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Mutations in this gene have been identified as the cause of congenital merosin-deficient muscular dystrophy. Two transcript variants encoding different proteins have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-33383
Species: Hu
Applications: WB, ICC/IF
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-144
Species: Hu, Mu, Rt, In, Rb, Sh
Applications: WB, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55584
Species: Hu
Applications: ICC/IF
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-42392
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-94712
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003908-M02
Species: Hu
Applications: WB, ELISA

Publications for Laminin alpha 2 Antibody (H00003908-M02) (0)

There are no publications for Laminin alpha 2 Antibody (H00003908-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin alpha 2 Antibody (H00003908-M02) (0)

There are no reviews for Laminin alpha 2 Antibody (H00003908-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laminin alpha 2 Antibody (H00003908-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Laminin alpha 2 Products

Bioinformatics Tool for Laminin alpha 2 Antibody (H00003908-M02)

Discover related pathways, diseases and genes to Laminin alpha 2 Antibody (H00003908-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin alpha 2 Antibody (H00003908-M02)

Discover more about diseases related to Laminin alpha 2 Antibody (H00003908-M02).
 

Pathways for Laminin alpha 2 Antibody (H00003908-M02)

View related products by pathway.

PTMs for Laminin alpha 2 Antibody (H00003908-M02)

Learn more about PTMs related to Laminin alpha 2 Antibody (H00003908-M02).

Blogs on Laminin alpha 2

There are no specific blogs for Laminin alpha 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin alpha 2 Antibody (1A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMA2
Uniprot