Lamin B Receptor Recombinant Protein Antigen

Images

 
There are currently no images for Lamin B Receptor Protein (NBP2-14185PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lamin B Receptor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LBR.

Source: E. coli

Amino Acid Sequence: MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFRQRKGGSTSSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LBR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14185.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lamin B Receptor Recombinant Protein Antigen

  • DHCR14B
  • FLJ43126
  • Integral nuclear envelope inner membrane protein
  • lamin B receptor
  • lamin-B receptor
  • LMN2R
  • MGC9041
  • PHA

Background

Lamins are nuclear membrane proteins that serve to maintain specific cellular functions, such as DNA replication and chromatin organization (1). Lamin B receptor (LBR) is an integral protein of the nuclear envelope inner membrane. It is phosphorylated by CDC2 protein kinase in mitosis when the inner nuclear membrane breaks down into vesicles that dissociate from the lamina and the chromatin. It is phosphorylated by different protein kinases in interphase when the membrane is associated with these structures (2). The cleavage of lamins results in nuclear disregulation and cell death (3,4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

202-IL
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
NBP1-89366
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-25228
Species: Hu
Applications: ICC/IF
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
201-LB
Species: Hu
Applications: BA
DR2A00
Species: Hu
Applications: ELISA
M5000
Species: Mu
Applications: ELISA

Publications for Lamin B Receptor Protein (NBP2-14185PEP) (0)

There are no publications for Lamin B Receptor Protein (NBP2-14185PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lamin B Receptor Protein (NBP2-14185PEP) (0)

There are no reviews for Lamin B Receptor Protein (NBP2-14185PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lamin B Receptor Protein (NBP2-14185PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lamin B Receptor Products

Blogs on Lamin B Receptor

There are no specific blogs for Lamin B Receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lamin B Receptor Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LBR