LACTB Antibody - BSA Free

Immunohistochemistry-Paraffin: Beta Lactamase Antibody [NBP1-91700] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: Beta Lactamase Antibody [NBP1-91700] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Beta Lactamase Antibody [NBP1-91700] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Beta Lactamase Antibody [NBP1-91700] - Staining in human testis and pancreas tissues using anti-LACTB antibody. Corresponding LACTB RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LACTB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LACTB Antibody - BSA Free (NBP1-91700) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NSNENLLPGYLKPETMVMMWTPVPNTEMSWDKEGKYAMAWGVVEKKQTYGSCRKQRHYASHTGGAVGASSVLLVLPEELDTETINNKVP
• Predicted Species: Mouse (97%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LACTB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LACTB Recombinant Protein Antigen (NBP1-91700PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LACTB Antibody - BSA Free

• AmpC
• EC 3.4
• FLJ14902
• G24
• lactamase, beta
• mitochondrial 39S ribosomal protein L56
• mitochondrial ribosomal protein L56
• MRPL56
• serine beta lactamase-like protein LACTB
• serine beta-lactamase-like protein LACTB, mitochondrial

Background

This gene encodes a mitochondrially-localized protein that has sequence similarity to prokaryotic beta-lactamases. Many of the residues responsible for beta-lactamase activity are not conserved in this protein, suggesting it may have a different enzymatic function. Increased expression of the related mouse gene was found to be associated with obesity. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Dec 2013]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LACTB