Lactate Dehydrogenase C Antibody - BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Lactate Dehydrogenase C (NP_002292.1).
Sequence: ISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSW |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LDHC |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Lactate Dehydrogenase C Antibody - BSA Free
Background
Lactate dehydrogenase (LDH) is an ubiquitous enzyme commonly found in wide variety of organisms, including plants and microbes. LDH is involved in the interconversion of the pyruvate and NADH to lactate and NAD+. It is also called Hydroxybutyrate Dehydrogenase (HBD), because it can catalyze the oxidation of hydroxybutyrate (1). In mammals, three types of LDH subunits (35 kDa) are encoded by the genes Ldh-A, Ldh-B, and Ldh-C. All LDH subunits can combine to form various terameric isoenzymes (140 kDa) (2). LDHA and LDHB are expressed in most somatic tissues, while expression of LDHC is confined to the germinal epithelium of the testes (3)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: IHC-P, WB
Publications for Lactate Dehydrogenase C Antibody (NBP3-35491) (0)
There are no publications for Lactate Dehydrogenase C Antibody (NBP3-35491).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lactate Dehydrogenase C Antibody (NBP3-35491) (0)
There are no reviews for Lactate Dehydrogenase C Antibody (NBP3-35491).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lactate Dehydrogenase C Antibody (NBP3-35491) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Lactate Dehydrogenase C Products
Research Areas for Lactate Dehydrogenase C Antibody (NBP3-35491)
Find related products by research area.
|
Blogs on Lactate Dehydrogenase C