Kv3.3 Antibody - BSA Free

Western Blot: Kv3.3 Antibody [NBP3-10356] - Western blot analysis of Kv3.3 in Human liver. Antibody dilution at 1 ug/mL

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Kv3.3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kv3.3 Antibody - BSA Free (NBP3-10356) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Kv3.3 (NP_004968). Peptide sequence YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 80 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Kv3.3 Antibody - BSA Free

• KSHIIID
• KV3.3
• potassium voltage-gated channel subfamily C member 3
• potassium voltage-gated channel, Shaw-related subfamily, member 3
• SCA13
• Shaw-related voltage-gated potassium channel protein 3
• spinocerebellar ataxia 13
• voltage-gated potassium channel protein KV3.3
• Voltage-gated potassium channel subunit Kv3.3

Background

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNC3