Ku80/XRCC5 Recombinant Protein Antigen

Images

 
There are currently no images for Ku80/XRCC5 Recombinant Protein Antigen (NBP2-55954PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ku80/XRCC5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ku80/XRCC5.

Source: E. coli

Amino Acid Sequence: SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
XRCC5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55954.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ku80/XRCC5 Recombinant Protein Antigen

  • 80kDa
  • ATP-dependent DNA helicase 2 subunit 2
  • ATP-dependent DNA helicase II 80 kDa subunit
  • CTC85
  • CTCBF
  • EC 3.6.4.-
  • FLJ39089
  • G22P2
  • KARP1
  • KARP-1
  • Ku80
  • Ku86 autoantigen related protein 1,86 kDa subunit of Ku antigen
  • Ku86
  • Ku86DNA repair protein XRCC5
  • KUB2
  • NFIV
  • Thyroid-lupus autoantigen
  • TLAA
  • X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining)CTC box-binding factor 85 kDa subunit
  • X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining; Ku autoantigen, 80kD)
  • X-ray repair cross-complementing protein 5
  • X-ray repair, complementing defective, repair in Chinese hamster
  • XRCC5

Background

Ku80, also known as XRCC5, plays a role in many diverse processes including cell signaling, proliferation, DNA repair, replication, transcriptional activation and apoptosis.

As one half of the heterodimer complex Ku, Ku80 is required for proper maintenance of the telomeric C strand. Ku80 also plays a role in DNA repair as an essential subunit of DNA-dependent protein kinase (DNA-PK) that phosphorylates certain transcription factors (Sp1, Oct-1 and p53). The heterodimer Ku binds double stranded DNA breaks for non-homologous end joining repair. Ku mutants are defective in T-DNA integration and over-expression confers increased resistance to DNA damage agents and increased susceptibility to T-DNA transformation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22128
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00002547-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-89463
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF6696
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF771
Species: Mu
Applications: IHC, Neut, WB
NBP1-81404
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13878
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, In vitro, KD, WB
NBP1-77975
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-55954PEP
Species: Hu
Applications: AC

Publications for Ku80/XRCC5 Recombinant Protein Antigen (NBP2-55954PEP) (0)

There are no publications for Ku80/XRCC5 Recombinant Protein Antigen (NBP2-55954PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ku80/XRCC5 Recombinant Protein Antigen (NBP2-55954PEP) (0)

There are no reviews for Ku80/XRCC5 Recombinant Protein Antigen (NBP2-55954PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ku80/XRCC5 Recombinant Protein Antigen (NBP2-55954PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ku80/XRCC5 Products

Research Areas for Ku80/XRCC5 Recombinant Protein Antigen (NBP2-55954PEP)

Find related products by research area.

Blogs on Ku80/XRCC5

There are no specific blogs for Ku80/XRCC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ku80/XRCC5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol XRCC5