Ku80/XRCC5 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XRCC5. Source: E. coli
Amino Acid Sequence: LKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
XRCC5 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87829. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Ku80/XRCC5 Recombinant Protein Antigen
Background
Ku80, also known as XRCC5, plays a role in many diverse processes including cell signaling, proliferation, DNA repair, replication, transcriptional activation and apoptosis.
As one half of the heterodimer complex Ku, Ku80 is required for proper maintenance of the telomeric C strand. Ku80 also plays a role in DNA repair as an essential subunit of DNA-dependent protein kinase (DNA-PK) that phosphorylates certain transcription factors (Sp1, Oct-1 and p53). The heterodimer Ku binds double stranded DNA breaks for non-homologous end joining repair. Ku mutants are defective in T-DNA integration and over-expression confers increased resistance to DNA damage agents and increased susceptibility to T-DNA transformation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for Ku80/XRCC5 Protein (NBP1-87829PEP) (0)
There are no publications for Ku80/XRCC5 Protein (NBP1-87829PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ku80/XRCC5 Protein (NBP1-87829PEP) (0)
There are no reviews for Ku80/XRCC5 Protein (NBP1-87829PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Ku80/XRCC5 Protein (NBP1-87829PEP) (0)
Additional Ku80/XRCC5 Products
Research Areas for Ku80/XRCC5 Protein (NBP1-87829PEP)
Find related products by research area.
|
Blogs on Ku80/XRCC5