KRT81 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AESWYRSKCEEMKATVIRHGETLRRTKEEINELN |
| Predicted Species |
Mouse (94%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KRT81 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KRT81 Antibody - BSA Free
Background
KRT81 is encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin, as well as KRTHB3 and KRTHB6, is found primarily in the hair cortex. Mutations in this gene and KRTHB6 have been observed in patients with a rare dominant hair disease, monilethrix. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: COMET, CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for KRT81 Antibody (NBP2-57133) (0)
There are no publications for KRT81 Antibody (NBP2-57133).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KRT81 Antibody (NBP2-57133) (0)
There are no reviews for KRT81 Antibody (NBP2-57133).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for KRT81 Antibody (NBP2-57133) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KRT81 Products
Research Areas for KRT81 Antibody (NBP2-57133)
Find related products by research area.
|
Blogs on KRT81