KRT28 Antibody

Images

 
Immunohistochemistry-Paraffin: KRT28 Antibody [NBP2-57281] - Staining of human hair follicles shows strong cytoplasmic positivity in cells in root sheath.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRT28 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FCSLGTLQFCIDKVNISQNTMSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGSHAGGALGNAACIGFAGSEG
Specificity
Specificity of human KRT28 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT28
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KRT28 Recombinant Protein Antigen (NBP2-57281PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KRT28 Antibody

  • cytokeratin-28
  • K25D
  • K28
  • keratin 25D
  • keratin 28
  • keratin, type I cytoskeletal 28
  • keratin-28
  • KRT25D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-29429
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb, Re, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, Flow-IC, Single-Cell Western
H00006301-M01
Species: Hu, Mu, Ze
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP2-20262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-58547
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-97080
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-84330
Species: Hu
Applications: WB
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-87466
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-85137
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP2-12873
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Ha, Ma, Pm, Rb, Sh, Xp
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IP

Publications for KRT28 Antibody (NBP2-57281) (0)

There are no publications for KRT28 Antibody (NBP2-57281).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT28 Antibody (NBP2-57281) (0)

There are no reviews for KRT28 Antibody (NBP2-57281). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KRT28 Antibody (NBP2-57281) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KRT28 Products

Bioinformatics Tool for KRT28 Antibody (NBP2-57281)

Discover related pathways, diseases and genes to KRT28 Antibody (NBP2-57281). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRT28

There are no specific blogs for KRT28, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRT28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT28