Kremen-1 Antibody (1E7) - Azide and BSA Free

Sandwich ELISA: Kremen-1 Antibody (1E7) [H00083999-M01] - Detection limit for recombinant GST tagged KREMEN1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Kremen-1 Antibody (1E7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Kremen-1 Antibody (1E7) - Azide and BSA Free (H00083999-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: KREMEN1 (NP_114434, 310 a.a. ~ 391 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE
• Specificity: KREMEN1 - kringle containing transmembrane protein 1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KREMEN1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kremen-1 Antibody (1E7) - Azide and BSA Free

• EC 3.4.21
• FLJ31863
• KREMEM1
• kremen protein 1
• KREMEN
• Kremen1
• Kremen-1
• kringle containing transmembrane protein 1
• kringle containing transmembrane protein
• Kringle domain-containing transmembrane protein 1
• kringle-coding gene marking the eye and the nose
• Kringle-containing protein marking the eye and the nose
• KRM1
• KRM1Dickkopf receptor

Background

This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KREMEN1
• Entrez:
  • 83999(Human)
• Uniprot:
  • NP_114434()