KPNA6 Antibody


Western Blot: KPNA6 Antibody [NBP1-52953] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

KPNA6 Antibody Summary

Synthetic peptides corresponding to KPNA6(karyopherin alpha 6 (importin alpha 7)) The peptide sequence was selected from the N terminal of KPNA6. Peptide sequence STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP.
This product is specific to Subunit or Isoform: alpha-7.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KPNA6 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KPNA6 Antibody

  • importin alpha 7 subunit
  • importin subunit alpha-7
  • importin-alpha-S2
  • IPOA7FLJ11249
  • karyopherin alpha 6 (importin alpha 7)
  • Karyopherin subunit alpha-6
  • KPNA7
  • MGC17918


The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. KPNA6 is a member of the importin alpha family.Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. The protein encoded by this gene is a member of the importin alpha family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Mu
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB

Publications for KPNA6 Antibody (NBP1-52953) (0)

There are no publications for KPNA6 Antibody (NBP1-52953).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KPNA6 Antibody (NBP1-52953) (0)

There are no reviews for KPNA6 Antibody (NBP1-52953). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KPNA6 Antibody (NBP1-52953) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KPNA6 Products

Bioinformatics Tool for KPNA6 Antibody (NBP1-52953)

Discover related pathways, diseases and genes to KPNA6 Antibody (NBP1-52953). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KPNA6 Antibody (NBP1-52953)

Discover more about diseases related to KPNA6 Antibody (NBP1-52953).

Pathways for KPNA6 Antibody (NBP1-52953)

View related products by pathway.

PTMs for KPNA6 Antibody (NBP1-52953)

Learn more about PTMs related to KPNA6 Antibody (NBP1-52953).

Research Areas for KPNA6 Antibody (NBP1-52953)

Find related products by research area.

Blogs on KPNA6

There are no specific blogs for KPNA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KPNA6 Antibody and receive a gift card or discount.


Gene Symbol KPNA6