KLHL7 Antibody

Images

 
Western Blot: KLHL7 Antibody [NBP1-82871] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: KLHL7 Antibody [NBP1-82871] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: KLHL7 Antibody [NBP1-82871] - Staining of human heart muscle shows moderate membranous positivity in intercalated discs.
Western Blot: KLHL7 Antibody [NBP1-82871] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-302

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHL7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TWTELCPMIEARKNHGLVFVKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVVDTCGANE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KLHL7 Protein (NBP1-82871PEP)
Publications
Read Publication using NBP1-82871.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLHL7 Antibody

  • kelch (Drosophila)-like 6
  • kelch/BTB
  • kelch-like 6
  • kelch-like 7 (Drosophila)
  • kelch-like protein 7
  • KLHL6
  • RP42
  • SBBI26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
H00054165-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-02939
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-87008
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP2-45512
Species: Hu
Applications: WB, IHC
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-56152
Species: Hu
Applications: ICC/IF

Publications for KLHL7 Antibody (NBP1-82871)(1)

Reviews for KLHL7 Antibody (NBP1-82871) (0)

There are no reviews for KLHL7 Antibody (NBP1-82871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KLHL7 Antibody (NBP1-82871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHL7 Products

Bioinformatics Tool for KLHL7 Antibody (NBP1-82871)

Discover related pathways, diseases and genes to KLHL7 Antibody (NBP1-82871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL7 Antibody (NBP1-82871)

Discover more about diseases related to KLHL7 Antibody (NBP1-82871).
 

Pathways for KLHL7 Antibody (NBP1-82871)

View related products by pathway.

PTMs for KLHL7 Antibody (NBP1-82871)

Learn more about PTMs related to KLHL7 Antibody (NBP1-82871).
 

Research Areas for KLHL7 Antibody (NBP1-82871)

Find related products by research area.

Blogs on KLHL7

There are no specific blogs for KLHL7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL7