KLHDC10 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KLHDC10 Antibody [NBP1-81528] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: KLHDC10 Antibody [NBP1-81528] - Staining of human testis shows strong cytoplasmic positivity in cells of the seminiferus ducts.

Staining of human lymph node shows no cytoplasmic positivity in germinal center cells as expected.

Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KLHDC10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KLHDC10 Antibody - BSA Free (NBP1-81528) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-KLHDC10 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIK
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLHDC10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KLHDC10 Protein (NBP1-81528PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KLHDC10 Antibody - BSA Free

• kelch domain containing 10
• KIAA0265kelch domain-containing protein 10
• PNAS-119
• scruin like at the midline homolog
• slim

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KLHDC10 Antibody (NBP1-81528)(1)

Publication using NBP1-81528

• Sandra Pankow, Casimir Bamberger, Diego Calzolari et al. F508 CFTR interactome remodelling promotes rescue of cystic fibrosis. Nature 2015-11-30 [PMID: 26618866] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: KLHDC10