KLF7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KLF7 Antibody [NBP1-80638] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KLF7 Antibody [NBP1-80638] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: KLF7 Antibody [NBP1-80638] - Staining of human duodenum shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: KLF7 Antibody [NBP1-80638] - Staining of human endometrium shows moderate nuclear positivity.
Immunohistochemistry-Paraffin: KLF7 Antibody [NBP1-80638] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLF7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGG
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLF7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KLF7 Protein (NBP1-80638PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLF7 Antibody

  • Krueppel-like factor 7
  • Kruppel-like factor 7 (ubiquitous)
  • ubiquitous Kruppel-like transcription factor
  • UKLFUbiquitous krueppel-like factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3499
Species: Hu
Applications: WB
AF1056
Species: Rt
Applications: IHC, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB300-213
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
MAB4974
Species: Hu
Applications: IHC
NBP2-37380
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
DLP00
Species: Hu
Applications: ELISA
AF3758
Species: Hu, Mu
Applications: ICC, KO, Simple Western, WB
256-GF/CF
Species: Hu
Applications: BA
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-68858
Species: Hu
Applications: IHC, IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-94897
Species: Mu, Rt
Applications: WB
NBP2-31896
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP1-87932
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-80467
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for KLF7 Antibody (NBP1-80638) (0)

There are no publications for KLF7 Antibody (NBP1-80638).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF7 Antibody (NBP1-80638) (0)

There are no reviews for KLF7 Antibody (NBP1-80638). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KLF7 Antibody (NBP1-80638) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLF7 Products

Bioinformatics Tool for KLF7 Antibody (NBP1-80638)

Discover related pathways, diseases and genes to KLF7 Antibody (NBP1-80638). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF7 Antibody (NBP1-80638)

Discover more about diseases related to KLF7 Antibody (NBP1-80638).
 

Pathways for KLF7 Antibody (NBP1-80638)

View related products by pathway.

PTMs for KLF7 Antibody (NBP1-80638)

Learn more about PTMs related to KLF7 Antibody (NBP1-80638).
 

Research Areas for KLF7 Antibody (NBP1-80638)

Find related products by research area.

Blogs on KLF7

There are no specific blogs for KLF7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF7
Entrez
Uniprot