KLF7 Antibody - BSA Free

Immunohistochemistry-Paraffin: KLF7 Antibody [NBP1-80638] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: KLF7 Antibody [NBP1-80638] - Staining of human duodenum shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: KLF7 Antibody [NBP1-80638] - Staining of human endometrium shows moderate nuclear positivity.

Immunohistochemistry-Paraffin: KLF7 Antibody [NBP1-80638] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KLF7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KLF7 Antibody - BSA Free (NBP1-80638) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-KLF7 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGG
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLF7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KLF7 Protein (NBP1-80638PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KLF7 Antibody - BSA Free

• Krueppel-like factor 7
• Kruppel-like factor 7 (ubiquitous)
• ubiquitous Kruppel-like transcription factor
• UKLFUbiquitous krueppel-like factor

Background

KLF7 is a transcriptional activator. It binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence. It is ubiquitous and highly expressed at low levels in brain and spinal cord in the adult, and in kidney and brain in the embryo. The acidic N terminal part may favor interaction with the basic domain of transcription factors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KLF7 Antibody (NBP1-80638)(2)

Publications using NBP1-80638

• Kataura T, Sedlackova L, Otten EG et al. Autophagy promotes cell survival by maintaining NAD levels Developmental cell 2022-11-21 [PMID: 36413951]
• Sakata Y, Cheng K, Mayama M et al. Reconstitution of human adrenocortical specification and steroidogenesis using induced pluripotent stem cells Developmental cell 2022-11-21 [PMID: 36413950]

Bioinformatics

• Gene Symbol: KLF7
• Entrez:
  • 8609(Human)
• Uniprot:
  • O75840(Human)