Recombinant Human KLF15 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human KLF15 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-416 of Human KLF15 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
KLF15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
70.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KLF15 Protein

  • DKFZp779M1320
  • kidney-enriched Kruppel-like factor
  • KKLFKidney-enriched krueppel-like factor
  • Krueppel-like factor 15
  • Kruppel-like factor 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP2-46842
Species: Hu
Applications: IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-86984
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF3158
Species: Mu
Applications: WB, ChIP, ICC
AF2945
Species: Hu
Applications: WB
NBP2-58952
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001188-P01
Species: Hu
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC, KO

Publications for KLF15 Recombinant Protein (H00028999-P01) (0)

There are no publications for KLF15 Recombinant Protein (H00028999-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF15 Recombinant Protein (H00028999-P01) (0)

There are no reviews for KLF15 Recombinant Protein (H00028999-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF15 Recombinant Protein (H00028999-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for KLF15 Recombinant Protein (H00028999-P01)

Discover related pathways, diseases and genes to KLF15 Recombinant Protein (H00028999-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF15 Recombinant Protein (H00028999-P01)

Discover more about diseases related to KLF15 Recombinant Protein (H00028999-P01).
 

Pathways for KLF15 Recombinant Protein (H00028999-P01)

View related products by pathway.

PTMs for KLF15 Recombinant Protein (H00028999-P01)

Learn more about PTMs related to KLF15 Recombinant Protein (H00028999-P01).

Blogs on KLF15

There are no specific blogs for KLF15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KLF15 Antibody
NBP2-24635

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KLF15 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF15