KLF14 Antibody - Azide and BSA Free

Western Blot: KLF14 Antibody [NBP3-15576] - Western blot analysis of extracts of various cell lines, using KLF14 antibody (NBP3-15576) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Western Blot: KLF14 Antibody [NBP3-15576] - Western blot analysis of extracts of HT-29 cells, using KLF14 antibody (NBP3-15576) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KLF14 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit KLF14 Antibody - Azide and BSA Free (NBP3-15576) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human KLF14 (NP_619638.2). PGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRIDPPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLF14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for KLF14 Antibody - Azide and BSA Free

• basic transcription element-binding protein 5
• Kruppel-like factor 14

Background

The KLF14 gene encodes a member of the Kruppel-like family of transcription factors. The gene exhibits imprinted expressionfrom the maternal allele in embryonic and extra-embryonic tissues. Expression of this gene is induced by TGF-beta, andthe protein repress

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: KLF14