KLF12 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

KLF12 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KLF12
  
  

  Source: E.coli

  Amino Acid Sequence: SSPTVITSVSSASSSSTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHRIPVVVQSVPVVYTAVRSPGNV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KLF12
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21391. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KLF12 Recombinant Protein Antigen

• AP-2rep transcription factor
• AP2REP
• AP-2rep
• AP2REPAP-2 repressor
• HSPC122
• KLF12 zinc finger transcriptional repressor
• KLF12
• Krueppel-like factor 12
• Kruppel-like factor 12
• Transcriptional repressor AP-2rep

Background

KLF12 is a gene the codes for a protein that bonds to A32 in the AP-2-alpha gene promoter in order to facilitate the transcriptional repression to the AP-2-alpha gene. KLF12 has two isoforms, with lengths of 402 and 269 amino acids, and weights of approximately 44 and 28 kDa respectively. Current studies are being done on diseases and disorders relating to this gene, including Wegener's granulomatosis, rheumatoid arthritis, gastric cancer, pancreatic cancer, pancreatitis, and schizophrenia. KLF12 has also been shown to have interactions with EHMT2, CTBP1, and SIRT2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KLF12