KLC1 Antibody

Images

 
Western Blot: KLC1 Antibody [NBP2-33649] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: KLC1 Antibody [NBP2-33649] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG
Specificity
Specificity of human KLC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
KLC1 Lysate (NBP2-65119)
Control Peptide
KLC1 Protein (NBP2-33649PEP)

Reactivity Notes

Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLC1 Antibody

  • hKLC1B
  • hKLC1G
  • hKLC1J
  • hKLC1S
  • kinesin 2 60/70kDa
  • kinesin 2
  • kinesin light chain 1
  • KLC 1
  • KLChKLC1N
  • KNS2AhKLC1P
  • KNS2hKLC1R
  • medulloblastoma antigen MU-MB-2.50
  • MGC15245

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-38794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF5346
Species: Hu
Applications: WB
NBP1-88995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1205
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-56137
Species: Hu
Applications: ICC/IF
AF4366
Species: Hu, Mu, Rt
Applications: WB
NB100-1925
Species: Ce, Hu(-), Ma(-), Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, KO
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79794
Species: Hu
Applications: WB, IHC, IP
AF4366
Species: Hu, Mu, Rt
Applications: WB
NBP1-87429
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KLC1 Antibody (NBP2-33649) (0)

There are no publications for KLC1 Antibody (NBP2-33649).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLC1 Antibody (NBP2-33649) (0)

There are no reviews for KLC1 Antibody (NBP2-33649). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLC1 Antibody (NBP2-33649) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KLC1 Antibody (NBP2-33649)

Discover related pathways, diseases and genes to KLC1 Antibody (NBP2-33649). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLC1 Antibody (NBP2-33649)

Discover more about diseases related to KLC1 Antibody (NBP2-33649).
 

Pathways for KLC1 Antibody (NBP2-33649)

View related products by pathway.

PTMs for KLC1 Antibody (NBP2-33649)

Learn more about PTMs related to KLC1 Antibody (NBP2-33649).

Blogs on KLC1

There are no specific blogs for KLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLC1
Uniprot